PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_19692A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 283aa    MW: 30246.2 Da    PI: 7.1777
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_19692AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding538e-171461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd+ lv +v++ G+g+W++++++ g+ R+ k+c++rw +yl
  Oropetium_20150105_19692A 14 KGPWTPEEDLVLVSYVQENGPGNWRAVPAKTGLMRCSKSCRLRWTNYL 61
                               79********************************************97 PP

2Myb_DNA-binding48.91.6e-1567112148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rg ++++Ed l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Oropetium_20150105_19692A  67 RGGFSEQEDRLIVHLQALLGNR-WAAIASYLP-DRTDNDVKNYWNTHL 112
                                7889******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-22564IPR009057Homeodomain-like
PROSITE profilePS5129417.814961IPR017930Myb domain
SuperFamilySSF466897.49E-3011108IPR009057Homeodomain-like
SMARTSM007172.7E-121363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001673.10E-101661No hitNo description
PROSITE profilePS5129424.67362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2365117IPR009057Homeodomain-like
SMARTSM007178.7E-1666114IPR001005SANT/Myb domain
PfamPF002491.5E-1467112IPR001005SANT/Myb domain
CDDcd001674.43E-1270112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGRPPCCHKA GVKKGPWTPE EDLVLVSYVQ ENGPGNWRAV PAKTGLMRCS KSCRLRWTNY  60
LRPGIRRGGF SEQEDRLIVH LQALLGNRWA AIASYLPDRT DNDVKNYWNT HLKKKLWELR  120
LQTDIDLARR ALREALSVDA AAHHPCPPPR TTTTTIVKST AAALADEPAA AQAPQPPYVG  180
LSACNVSVML DAWAPPPRAA ESASGSSSEH TDCSAAAGGS ASSASDCPGA TLAVKQDDEV  240
PLSAIESWLL GGDDGGEQLQ QLLVAHQAGL LRDAAALHSF AF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-28141164105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9628481e-135EU962848.1 Zea mays clone 246006 myb transcription factor MYB30 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630096.16e-96PREDICTED: myb-related protein 306-like
SwissprotP813923e-83MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0A9DP431e-107A0A0A9DP43_ARUDO; Uncharacterized protein
STRINGORGLA03G0181800.13e-96(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.26e-80myb domain protein 96